FXYD6 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-91915PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-91915PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

View all FXYD6 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FXYD6.

Source: E. coli

Amino Acid Sequence: SRRCKCSFNQKPRAPGDEEAQVENLITANATEP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-91915.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-91915PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: FXYD6

This reference sequence was derived from multiple replicate ESTs and validated by human genomic sequence. This geneencodes a member of a family of small membrane proteins that share a 35-amino acid signature sequence domain,beginning with the sequence PFXYD and containing 7 invariant and 6 highly conserved amino acids. The approved humangene nomenclature for the family is FXYD-domain containing ion transport regulator. FXYD2, also known as the gammasubunit of the Na,K-ATPase, regulates the properties of that enzyme. FXYD1 (phospholemman), FXYD2 (gamma), FXYD3(MAT-8), FXYD4 (CHIF), and FXYD5 (RIC) have been shown to induce channel activity in experimental expression systems.Transmembrane topology has been established for two family members (FXYD1 and FXYD2), with the N-terminusextracellular and the C-terminus on the cytoplasmic side of the membrane. This gene product, FXYD6, is novel and hasnot been characterized as a protein. Multiple alternatively spliced transcript variants that encode the same proteinisoform have been described. RefSeq curation by Kathleen J. Sweadner, Ph.D., sweadner@helix.mgh.harvard.edu.)

Alternate Names

FXYD domain containing ion transport regulator 6, FXYD domain-containing ion transport regulator 6, phosphohippolin

Gene Symbol

FXYD6

Additional FXYD6 Products

Product Documents for FXYD6 Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for FXYD6 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.