Skip to main content

G5pr Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-89907PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-89907PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PPP2R3C.

Source: E. coli

Amino Acid Sequence: LLDIENKGYLNVFSLNYFFRAIQELMKIHGQDPVSFQDVKDEIFDMVKPKDPLKISLQDLINSNQGDTVTTILIDLNGFWT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89907.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-89907PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: G5pr

G5pr may regulate MCM3AP phosphorylation through phosphatase recruitment. May play a role in the activation-induced cell death of B-cells

Alternate Names

C14orf10, chromosome 14 open reading frame 10, FLJ20644, G4-1, G5PR, protein phosphatase 2 (formerly 2A), regulatory subunit B'', gamma, protein phosphatase 2, regulatory subunit B'', gamma, Protein phosphatase subunit G5PR, rhabdomyosarcoma antigen MU-RMS-40.6A, Rhabdomyosarcoma antigen MU-RMS-40.6A/6C, rhabdomyosarcoma antigen Mu-RMS-40.6C, serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit gamma

Gene Symbol

PPP2R3C

Additional G5pr Products

Product Documents for G5pr Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for G5pr Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...