Skip to main content

Galectin-4 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-48605PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-48605PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Galectin-4.

Source: E. coli

Amino Acid Sequence: PGPGHCHQQLNSLPTMEGPPTFNPPVPYFGRLQGGLTARRTIIIKGYVPPTGKSFAINFKVGSS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-48605.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-48605PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: Galectin-4

Galectins are a family of soluble beta-galactoside-binding animal lectins that modulate cell-to-cell adhesion and cell-to-extracellular matrix (ECM) interactions and play a role in tumor progression, pre-mRNA splicing and apoptosis. One member of this family, Galectin-4, also known as Gal-4, L36 or LGALS4 maps to human chromosome 19q13.13 and encodes a 36-37 kDa protein. The Galectin-4 protein is composed of 323 amino acids and contains two homologous carbohydrate recognition domains (CRD) and all amino acids typically conserved in the galectin family. Expression of Galectin-4 correlates with the malignant potential of human hepatocellular carcinoma (HCC) and is differentially regulated depending on cell-cell contact, serum growth factors, cell growth and cell differentiation status. Galectin-4 expression is detected in epithelial cells of the colon, rectum, intestine, and in HT29 and LS174T cell lines. Galectin-4 is underexpressed in colorectal cancer and is preferentially upregulated in cells prone to peritoneal dissemination.

Alternate Names

GAL4, Galectin4, LGALS4

Gene Symbol

LGALS4

Additional Galectin-4 Products

Product Documents for Galectin-4 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Galectin-4 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...