Skip to main content

GFER/ALR Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-90187PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-90187PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GFER.

Source: E. coli

Amino Acid Sequence: QQDMAQFIHLFSKFYPCEECAEDLRKRLCRNHPDTRTRACFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-90187.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-90187PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: GFER/ALR

The hepatotrophic factor designated augmenter of liver regeneration (ALR) is thought to be one of the factorsresponsible for the extraordinary regenerative capacity of mammalian liver. It has also been called hepaticregenerative stimulation substance (HSS). The gene resides on chromosome 16 in the interval containing the locus forpolycystic kidney disease (PKD1). The putative gene product is 42% similar to the scERV1 protein of yeast. The yeastscERV1 gene had been found to be essential for oxidative phosphorylation, the maintenance of mitochondrial genomes,and the cell division cycle. The human gene is both the structural and functional homolog of the yeast scERV1 gene.(provided by RefSeq)

Long Name

Growth Factor, Augmenter of Liver Regeneration

Alternate Names

ALR, ERV1, Hepatopoietin, HERV1, HPO

Gene Symbol

GFER

Additional GFER/ALR Products

Product Documents for GFER/ALR Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for GFER/ALR Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...