GLRB Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-30683PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-30683PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

View all GLRB Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GLRB.

Source: E. coli

Amino Acid Sequence: MLNNPKRVEAEKARIAKAEQADGKGGNVAKKNTVNGTGTPVHISTLQVGETRCKKVCTSKSDLRSNDFSIVGSLPRDFELSNYDCYGKPIEVNNGLGKSQAKNNKKPPPAKPVIPTAAK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-30683.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-30683PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: GLRB

GLRB, also known as Glycine receptor subunit beta, has a 497 amino acid long isoform that is 56 kDa and a short 303 amino acid isoform that is 35 kDa, composed of alpha and beta subunits, responsible for mediating the inhibitory effects of glycine functioning as a neurotransmitter-gated ion channel which produces hyperpolarization via increased chloride conductance due to the binding of glycine to the receptor. Current research is being performed on several diseases and disorders including hyperekplexia, stiff-person syndrome, neurological disorder, autosomal recessive, startle disease, idiopathic generalized epilepsy, spasticity, pharyngitis, neuronitis, and lung cancer. This protein has also been shown to have interactions with GPHN and PFN1 in pathways such as neurophysiological process PGE2-induced pain processing, ligand-gated ion channel transport, transmembrane transport of small molecules, ion channel transport, and neuroactive ligand-receptor interaction.

Alternate Names

beta subunit, Glycine receptor 58 kDa subunit, glycine receptor, beta

Gene Symbol

GLRB

Additional GLRB Products

Product Documents for GLRB Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for GLRB Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.