Skip to main content

GNPDA1 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-33474PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-33474PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GNPDA2.

Source: E. coli

Amino Acid Sequence: LSKVPTMALTVGVGTVMDAREVMILITGAHKAFALYKAIEEGVNHMWTVSAFQQHPRTIFVCDEDAT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-33474.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-33474PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: GNPDA1

GNPDA1, also known as Glucosamine-6-phosphate isomerase 1, is a 289 amino acid that is 33 kDa, with homohexamer subunit structure and cytoplasm location; is an allosteric enzyme that catalyzes the reversible conversion of D-glucosamine-6-phosphate into D-fructose-6-phosphate and ammonium; and appears to trigger calcium oscillations in mammalian eggs which operate as the basic trigger for egg activation and early development of the embryo. Disease research is currently being studied with relation to GNPDA1 and lipoid nephrosis, hepatocellular carcinoma, and acute interstitial pneumonia. The protein has been linked to the amino sugar and nucleotide sugar metabolism and metabolic pathways where it interacts with MCC, EWSR1, ILF2, AMDHD2, and GP1.

Alternate Names

EC 3.5.99.6, GlcN6P deaminase 1, glucosamine-6-phosphate deaminase 1KIAA0060HLNGNPIGNPDA, glucosamine-6-phosphate isomerase, glucosamine-6-phosphate isomerase 1, GNP1, GNPDA 1, GPI, Oscillin

Gene Symbol

GNPDA1

Additional GNPDA1 Products

Product Documents for GNPDA1 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for GNPDA1 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...