Recombinant Human GPR12 GST (N-Term) Protein

Novus Biologicals, part of Bio-Techne | Catalog # H00002835-P01

Novus Biologicals, part of Bio-Techne
Discontinued Product
H00002835-P01 has been discontinued. View all GPR12 products.

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

ELISA, Affinity Purification, Microarray, Western Blot

View all GPR12 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-334 of Human GPR12

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MNEDLKVNLSGLPRDYLDAAAAENISAAVSSRVPAVEPEPELVVNPWDIVLCTSGTLISCENAIVVLIIFHNPSLRAPMFLLIGSLALADLLAGIGLITNFVFAYLLQSEATKLVTIGLIVASFSASVCSLLAITVDRYLSLYYALTYHSERTVTFTYVMLVMLWGTSICLGLLPVMGWNCLRDESTCSVVRPLTKNNAAILSVSFLFMFALMLQLYIQICKIVMRHAHQIALQHHFLATSHYVTTRKGVSTLAIILGTFAACWMPFTLYSLIADYTYPSIYTYATLLPATYNSIINPVIYAFRNQEIQKALCLICCGCIPSSLAQRARSPSDV

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

63.1 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human GPR12 GST (N-Term) Protein

SDS-PAGE: Recombinant Human GPR12 GST (N-Term) Protein [H00002835-P01]

SDS-PAGE: Recombinant Human GPR12 GST (N-Term) Protein [H00002835-P01]

SDS-Page: Recombinant Human GPR12 Protein [H00002835-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation and Storage

H00002835-P01
Preparation Method in vitro wheat germ expression system
Formulation 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -80C. Avoid freeze-thaw cycles.

Background: GPR12

GPCR GPR12 is a G protein coupled receptor. A variety of extracellular signals are transmitted into cells through integral membrane receptors coupled to heterotrimeric G proteins. Such G protein coupled receptors are critical for the normal functions of many cell types: neurons, endocrine cells, cardiac and smooth muscle cells, and sensory cells for detection of light, taste, and smell. Both activating and loss of function mutations in G protein coupled receptors have been found as the cause of human diseases. The GPR12 gene is located on human chromosome 13q12. GPR12 expression has been reported primarily in the central nervous system. Rat transcripts have been identified at low levels in testis and pituitary gland. ESTs have been isolated from human brain and eye libraries, as well as mouse brain.

Long Name

G Protein-coupled Receptor 12

Alternate Names

GPCR12, GPCR21

Gene Symbol

GPR12

Additional GPR12 Products

Product Documents for Recombinant Human GPR12 GST (N-Term) Protein

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Recombinant Human GPR12 GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.