GPR154 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-91966PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-91966PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

View all GPR154 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NPSR1.

Source: E. coli

Amino Acid Sequence: DILDNFNLLPDTQERFYASVIIQNLPALNSAINPLIYCVFSSSISFPCRERRSQDSRMTFRERTERHEMQILSKP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-91966.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-91966PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: GPR154

The GPR154 gene codes a neuropeptide S receptor plasma membrane protein as it is part of the G protein-coupled receptor 1 family. The protein encoded by the GPR154 gene is active in signaling pathway in several tissues in a paracrine or autocrine fashion through mediation of inhibitory effects on cell growth. Nine isoforms of this protein exist: isoform 1: 371 amino acids long, 42 kDA; isoform 2: 305 amino acids long, 35 kDA; isoform 3: 390 amino acids long, 44 kDA; isoform 4: 377 amino acids long, 43 kDA; isoform 5: 366 amino acids long, 41 kDA; isoform 6: 158 amino acids long, 18 kDA; isoform 7: 136 amino acids long, 15 kDA; isoform 8: 143 amino acids long, 16 kDA; and isoform 9: 94 amino acids long, 10 kDA; It is known to be involved in the pathogenesis of asthma and other IgE-mediated diseases because of increased expression in ciliated cells of the respiratory epithelium and in bronchial smooth muscle cells. Research has investigated its role in asthma, panic disorder, dermatitis, rabies, eczema, inflammatory bowel disease, rheumatoid arthritis, schizophrenia, and attention deficit hyperactivity disorder as well. The GPR154 gene participates in GPCR downstream signaling and ligand binding through interactions with various genes such as: ADYC2, ADORA2A, ADORA2B, ADRB2, and AVPR1B.

Alternate Names

G protein-coupled receptor 154, G protein-coupled receptor for asthma susceptibility, GPR154NPSR, GPRAASRT2, G-protein coupled receptor 154, G-protein coupled receptor for asthma susceptibility, G-protein coupled receptor PGR14, neuropeptide S receptor, neuropeptide S receptor 1, PGR14VRR1, vasopressin receptor-related receptor 1

Gene Symbol

NPSR1

Additional GPR154 Products

Product Documents for GPR154 Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for GPR154 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.