Skip to main content

Recombinant Human GPR162 Protein

Novus Biologicals, part of Bio-Techne | Catalog # H00027239-G01

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
H00027239-G01

Key Product Details

Source

Wheat germ

Conjugate

Unconjugated

Applications

Affinity Purification

Product Specifications

Description

An untagged recombinant protein corresponding to the amino acid sequence of (NP_055264.1) for Human GPR162

Source: Wheat Germ (in vitro) with proprietary liposome technology

Amino Acid Sequence: MLSTGVVSFFSLKSDSAPPWMVLAVLWCSMAQTLLLPSFIWSCERYRADVRTVWEQCVAIMSEEDGDDDGGCDDYAEGRVCKVRFDANGATGPGSRDPAQVKLLPGRHMLFPPLERVHYLQVPLSRRLSHDETNIFSTPREPGSFLHKWSSSDDIRVLPAQSRALGGPPEYLGQRHRLEDEEDEEEAEGGGLASLRQFLESGVLGSGGGPPRGPGFFREEITTFIDETPLPSPTASPGHSPRRPRPLGLSPRRLSLGSPESRAVGLPLGLSAGRRCSLTGGEESARAWGGSWGPGNPIFPQLTL

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

33.1 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Formulation, Preparation and Storage

H00027239-G01
Preparation Method in vitro wheat germ expression system with proprietary liposome technology
Formulation 25 mM Tris-HCl pH8.0 in 2% glycerol.
Preservative Glycerol
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -80C. Avoid freeze-thaw cycles.

Background: GPR162

GPR162, also known as Probable G-protein coupled receptor 162, has a 588 amino acid long isoform that is 64 kDa and a short 304 amino acid isoform that is 33 kDa, located in the cell membrane, mainly expressed in the brain; acts as an orphan receptor. This protein is being studied for its involvement in St. Louis encephalitis, amyotrophic lateral sclerosis, lymphoma, asphyxia neonatorum, dental caries, spotted fever, typhus, lyme disease, toxic shock syndrome, cystic fibrosis, purpura, pancreatic cancer, and pancreatitis. It has been inferred that GPR162 protein is involved in G-protein coupled receptor signaling pathway.

Long Name

G Protein-Coupled Receptor 162

Alternate Names

GRCA

Gene Symbol

GPR162

Additional GPR162 Products

Product Documents for Recombinant Human GPR162 Protein

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Recombinant Human GPR162 Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...