GPR50 Recombinant Protein Antigen
Novus Biologicals, part of Bio-Techne | Catalog # NBP2-56258PEP
Key Product Details
Source
Tag
Conjugate
Applications
Product Specifications
Description
Source: E. coli
Amino Acid Sequence: PTKPAASQLESDTIADLPDPTVVTTSTNDYHDVVVIDVEDDPDEMAV
Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Purity
Predicted Molecular Mass
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Applications
Application Notes
It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.
For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Protein / Peptide Type
Formulation, Preparation and Storage
NBP2-56258PEP
Formulation | PBS and 1M Urea, pH 7.4. |
Preservative | No Preservative |
Concentration | Please see the vial label for concentration. If unlisted please contact technical services. |
Shipping | The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below. |
Stability & Storage | Store at -20C. Avoid freeze-thaw cycles. |
Background: GPR50
GPR50, also known as MTR1L, is a nonglycosylated seven-transmembrane G protein-coupled receptor that is related to the melatonin receptors MT1 and MT2. GPR50 is expressed in the hippocampus, hypothalamus, and pituitary and forms 130 kDa homodimers. It heterodimerizes with either MT1 or MT2, resulting in inhibition of MT1 but not MT2 function. An alternately spliced isoform of GPR50 has a 4 aa deletion in the large C-terminal cytoplasmic domain. The presence of this deletion as well as various polymorphisms in GPR50 have been associated with elevated serum triglyceride and HDL levels. The deletion may also be associated with the development of bipolar disorder. Human GPR50 shares approximately 70% aa sequence identity with mouse and rat GPR50.
Long Name
Alternate Names
Gene Symbol
Additional GPR50 Products
Product Documents for GPR50 Recombinant Protein Antigen
Product Specific Notices for GPR50 Recombinant Protein Antigen
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.