GSTM3 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-83323PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-83323PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

View all GSTM3 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GSTM3.

Source: E. coli

Amino Acid Sequence: TYDILDQNRIFDPKCLDEFPNLKAFMCRFEALEKIAAYLQSDQFCKMPINN

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83323.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-83323PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: GSTM3

GSTM3, also known as Glutathione S-transferase Mu 3, is a 225 amino acid that is approx. 27 kDa; is responsible for conjugation of reduced glutathione to an extensive number of exogenous and endogenous hydrophobic electrophiles, and may be able to regulate uptake and detoxification of both endogenous compounds and xenobiotics at the testis and brain blood barriers. Current research is being performed on over 70 diseases and disorders including laryngeal squamous cell carcinoma, pharyngitis, laryngitis, squamous cell carcinoma, laryngeal cancer, oral cancer, cataract, colorectal cancer, carcinoma, breast cancer, astrocytoma, non-Hodgkin lymphoma, malignant pleural mesothelioma, open-angle glaucoma, Hodgkin's lymphoma, lung cancer, basal cell carcinoma, adult brain tumor, and leukoplakia. This protein has been shown to have interactions with over 70 proteins including RBL2, GSTM2, PAK2, MPG, and TFE3 in pathways such as glutathione metabolism, metabolism of xenobiotics by cytochrome P450, drug metabolism - cytochrome P450, establishment of blood-nerve barrier, and response to estrogen stimulus pathway.

Alternate Names

glutathione S-transferase mu 3 (brain), GST5Mu-3, MGC3310, MGC3704, S-(hydroxyalkyl)glutathione lyase M3

Gene Symbol

GSTM3

Additional GSTM3 Products

Product Documents for GSTM3 Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for GSTM3 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.