HEXB Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-48689PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-48689PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

View all Hexosaminidase B/HEXB Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HEXB.

Source: E. coli

Amino Acid Sequence: PSVSAKPGPALWPLPLSVKMTPNLLHLAPENFYISHSPNSTAGPSCTLLEEAFRRYHGYI

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-48689.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-48689PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: Hexosaminidase B/HEXB

HEXB, also known as Beta-hexosaminidase subunit beta, is a 556 amino acid that is 63 kDa, lysosome located, composed of two subunits, alpha and beta, which are encoded by separate gene, and in control of the degradation of GM2 gangliosides and other molecules containing terminal N-acetyl hexosamines, in the brain and other tissues. Current research is being performed on several diseases and disorders including gangliosidosis, sandhoff disease, infantile, juvenile, and adult forms, tay-sachs disease, neuronitis, lysosomal storage disease, motor neuron disease, cervical cancer, mucopolysaccharidosis, cervicitis, neurodegenerative disease, recurrent respiratory papillomatosis, hairy cell leukemia, macrocephaly, autonomic dysfunction, cholesteatoma, type 2 diabetes mellitus, rheumatoid arthritis, and diarrhea. The protein has been linked to pathways such as glycan degradation, amino sugar and nucleotide sugar metabolism, glycosaminoglycan degradation, glycosphingolipid biosynthesis - globo series, glycosphingolipid biosynthesis - ganglio series, MPS VI - Maroteaux-Lamy syndrome, metabolic pathways, and lysosome pathways where it interacts with EIF2D, GYG1, CSNK2B, CHIA,CHIT1, and CHIT1 proteins.

Alternate Names

ENC-1AS, HCC-7, HEL-248, HEXB

Gene Symbol

HEXB

Additional Hexosaminidase B/HEXB Products

Product Documents for HEXB Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for HEXB Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.