HNF-4 gamma/NR2A2 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-82531PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-82531PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

View all HNF-4 gamma/NR2A2 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HNF4G.

Source: E. coli

Amino Acid Sequence: WQMIEQIQFVKLFGMVKIDNLLQEMLLGGASNDGSHLHHPMHPHLSQDPLTGQTILLGPMSTLVHADQISTPETPLPSPPQGSGQEQYKIAANQASVISHQHLSKQKQ

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-82531.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-82531PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: HNF-4 gamma/NR2A2

Hepatocyte nuclear factor 4 gamma (HNF4 gamma) is a NR2 Hepatocyte NF4-Like receptor of relatively unknown function. Although HNF4 gamma is structurally related to HNF4 alpha and is expressed together with HNF 4 Alpha in pancreatic islets, it does not play a major role in the etiology of early onset, autosomal dominant, non insulin-dependent type 2 diabetes or maturity-onset diabetes of the young, MODY1. A pseudogene of HNF4 gamma, located on chromosome 13 (13q14.11 - 13q14.3), has been recently identified using a comparative genomics approach. HNF4 gamma expression has been reported human pancreas, kidney, testis, small intestine, and colon. ESTs have been isolated from human tissue libraries, including cancerous brain and colon, and normal brain,stomach, and liver.

Long Name

Hepatocyte Nuclear Factor 4 gamma

Alternate Names

HNF4 gamma, HNF4G, NR2A2

Gene Symbol

HNF4G

Additional HNF-4 gamma/NR2A2 Products

Product Documents for HNF-4 gamma/NR2A2 Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for HNF-4 gamma/NR2A2 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.