Skip to main content

IGSF8/CD316 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-21398PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP3-21398PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human IGSF8/CD316

Source: E.coli

Amino Acid Sequence: RLVAQLDTEGVGSLGPGYEGRHIAMEKVASRTYRLRLEAARPGDAGTYRCLAKAYVRGSGTRLREAASARSRPLPVHVRE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10-100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-21398. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP3-21398PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: IGSF8/CD316

IGSF8 is a gene that codes for a protein that plays a role in diverse functions from oocytes fertilization to hepatitis C virus function, as well as working as a regulator of cell motility and neurite outgrowth and has three isomers with lengths of 613, 372, and 526 amino acids and weights of approximately 65, 40, and 56 kDa respectively. Current studies are being done on several diseases and disorders related to this gene including hepatitis C, prostate cancer, and glioblastoma. IGSF8 has also been shown to have interactions with CD81, CD9, CD82, ITGB1, and ADAM10.

Long Name

Immunoglobulin Superfamily, Member 8

Alternate Names

CD316, CD81P3, EWI2, KCT4, PGRL

Gene Symbol

IGSF8

Additional IGSF8/CD316 Products

Product Documents for IGSF8/CD316 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for IGSF8/CD316 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...