Skip to main content

IKEPP Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-17195PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP3-17195PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human IKEPP

Source: E. coli

Amino Acid Sequence: PSTLSGHRVCQAHGEPVLGLCPLLPLFCCPPHPPDPWSLERPRFCLLSKEEGKSFGFHLQQELGRAGHVVCRVDPGTSAQRQGLQEGDRILAVNNDV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10-100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17195.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP3-17195PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: IKEPP

IKEPP, also known as PDZD3, associates with GUCY2C to act as a regulatory protein and negatively modulates the heat-stable enterotoxin-mediated activation of GUCY2C. Specifically, IKEPP regulates the amount of cGMP produced following receptor stimulation. IKEPP has also been found to stimulate SLC9A3 activity in the presence of elevated calcium ions.

Alternate Names

FLJ22756, IKEPPPDZK2, intestinal and kidney enriched PDZ protein, Intestinal and kidney-enriched PDZ protein, Na(+)/H(+) exchange regulatory cofactor NHE-RF4, Na/Pi cotransporter C-terminal-associated protein 2, NaPi-Cap2, Natrium-phosphate cotransporter IIa C-terminal-associated protein 2, NHERF4, NHERF-4, PDZ domain containing 2, PDZ domain containing 3, PDZ domain-containing protein 2, PDZ domain-containing protein 3, Sodium-hydrogen exchanger regulatory factor 4

Gene Symbol

NHERF4

Additional IKEPP Products

Product Documents for IKEPP Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for IKEPP Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...