IL-3R alpha/CD123 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-86549PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-86549PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

View all IL-3R alpha Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human IL3RA.

Source: E. coli

Amino Acid Sequence: PPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDIS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86549.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-86549PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: IL-3R alpha

IL3RA (CD123) is a member of the immunoglobulin superfamily that is expressed on hematopoietic progenitors, basophils, mast cells, and megakaryocytes. This transmembrane glycoprotein can bind IL3 with low affinity but cannot transduce signals without association with additional protein partners. CD123 can complex with either common beta chain (CDw131) or the IL3RB chain to form high affinity heterodimeric IL3 receptors. CDw131 can complex with the Alpha subunits of the mouse IL3R, IL5R and GMCSFR to form high affinity receptors, while the IL3RB subunit is specific for IL3 but binds with low affinity. IL3 binding to the receptor complex can induce proliferation and differentiation of hematopoietic cells. It is present in Hematopoietic progenitors, basophils, mast cells and megakaryocytes.

Long Name

Interleukin 3 Receptor alpha

Alternate Names

CD123, IL-3 R alpha, IL-3Ra, IL3R alpha, IL3RA

Gene Symbol

IL3RA

Additional IL-3R alpha Products

Product Documents for IL-3R alpha/CD123 Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for IL-3R alpha/CD123 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.