Skip to main content

IL-9R Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-68806PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-68806PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human IL-9 R.

Source: E. coli

Amino Acid Sequence: LTNNILRIDCHWSAPELGQGSSPWLLFTSNQAPGGTHKCILRGSECTVVLPPEAVLVPSDNFTITFHHCMSGREQVSLVDPEYLPRR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10-100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-68806.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-68806PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: IL-9R

The protein encoded by the IL9R gene is a cytokine receptor that specifically mediates the biological effects ofinterleukin 9 (IL9). The functional IL9 receptor complex requires this protein as well as the interleukin 2 receptor,gamma (IL2RG), a common gamma subunit shared by the receptors of many different cytokines. The ligand binding of thisreceptor leads to the activation of various JAK kinases and STAT proteins, which connect to different biologicresponses. This gene is located at the pseudoautosomal regions of X and Y chromosomes. Genetic studies suggested anassociation of this gene with the development of asthma. Multiple pseudogenes on chromosome 9, 10, 16, and 18 havebeen described. Alternatively spliced transcript variants have been found for this gene. (provided by RefSeq)

Long Name

Interleukin 9 Receptor

Alternate Names

CD129, IL-9 R, IL9R

Gene Symbol

IL9R

Additional IL-9R Products

Product Documents for IL-9R Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for IL-9R Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...