KCNK13 Antibody Blocking Peptide
Novus Biologicals, part of Bio-Techne | Catalog # NBP2-41132PEP
Key Product Details
Product Specifications
Description
A recombinant protein antigen 15 amino acids near the center of human KCNK13.
Source: E. coli
Amino Acid Sequence: DSTVIWRVLYNQGKQWLEATIQLGRLSQPFHLSLDKVSLGIYDGVSAIDDIRFENCTLPLPAESCEGLDHFWCRHTRACIEKLRLCD
Store KCNK13 Antibody Blocking Peptide at -20C, stable for one year.
Application Notes
KCNK13 peptide is used for blocking the activity of KCNK13 antibody NBP2-41132.
Protein / Peptide Type
Antibody Blocking Peptide
Scientific Data Images for KCNK13 Antibody Blocking Peptide
Western blot analysis of KCNK13 in rat brain tissue lysate
Western blot analysis of KCNK13 in rat brain tissue lysate with KCNK13 antibody at 0.5 ug/mL in (A) the absence and (B) the presence of blocking peptide.Formulation, Preparation and Storage
NBP2-41132PEP
| Formulation | PBS pH 7.2 (10 mM NaH2PO4, 10 mM Na2HPO4, 130 mM NaCl) containing 0.1% bovine serum albumin |
| Preservative | 0.02% Sodium Azide |
| Concentration | 0.2 mg/ml |
| Shipping | The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below. |
| Stability & Storage | Store at -20C. Avoid freeze-thaw cycles. |
Background: KCNK13
Alternate Names
K2p13.1, potassium channel subfamily K member 13, potassium channel, subfamily K, member 13, tandem pore domain potassium channel THIK-1, THIK-1
Gene Symbol
KCNK13
UniProt
Additional KCNK13 Products
Product Documents for KCNK13 Antibody Blocking Peptide
Product Specific Notices for KCNK13 Antibody Blocking Peptide
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.
Loading...
Loading...
Loading...