Kirrel2/NEPH3 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-68922PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-68922PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

View all Kirrel2/NEPH3 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Kirrel2/NEPH3.

Source: E. coli

Amino Acid Sequence: GVPANLTCRSRGDARPTPELLWFRDGVLLDGATFHQTLLKEGTPGSVESTLTLTPFSHDDGATFVCRARSQALPTGRDTAITLS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10-100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-68922.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking tide related information and a protocol, click here.

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-68922PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: Kirrel2/NEPH3

Kirrel (kin of irregular chiasm-1-like) proteins, also known as the NEPH (nephrin-like) family, are type I transmembrane glycoproteins within the immunoglobulin superfamily. Kirrel1 (NEPH1), Kirrel2 (NEPH3, Filtrin, NLG-1) and Kirrel3 (NEPH2, kirre) share 34 - 44% amino acid (aa) identity, and all interact with nephrin, podocin and the adaptor molecule ZO-1 (1, 4). All can be found in podocytes of the kidney glomerulus, and play a role in barrier function in the slit diaphragm. (2-6). Kirrel1 can also be found in central nervous system neurons, pancreas and placenta, Kirrel2 in pancreatic islet beta cells, brain and lymph nodes, and Kirrel3 in the brain and bone marrow, typically at sites where nephrin is also expressed.

Long Name

Kin of Irregular Chiasm-like 2, Splice Variant A

Alternate Names

Filtrin, NEPH3, NLG1

Gene Symbol

KIRREL2

Additional Kirrel2/NEPH3 Products

Product Documents for Kirrel2/NEPH3 Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Kirrel2/NEPH3 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.