Recombinant Human KRTAP17-1 GST (N-Term) Protein
Novus Biologicals, part of Bio-Techne | Catalog # H00083902-P01
Key Product Details
Source
Wheat germ
Tag
GST (N-Term)
Conjugate
Unconjugated
Applications
ELISA, Affinity Purification, Microarray, Western Blot
Product Specifications
Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-105 of Human KRTAP17-1
Source: Wheat Germ (in vitro)
Amino Acid Sequence: MGCCPGDCFTCCTQEQNCCEECCCQPGCCGCCGSCCGCGGSGCGGSGCGGSCCGSSCCGSGCGGCGGCGGCGGGCCGSSCCGSSCCGSGCCGPVCCQPTPICDTK
Purity
>80% by SDS-PAGE and Coomassie blue staining
Predicted Molecular Mass
38.5 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Activity
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Protein / Peptide Type
Recombinant Protein
Scientific Data Images for Recombinant Human KRTAP17-1 GST (N-Term) Protein
12.5% SDS-PAGE Stained with Coomassie Blue.
Formulation, Preparation and Storage
H00083902-P01
Preparation Method | in vitro wheat germ expression system |
Formulation | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
Preservative | No Preservative |
Concentration | Please see the vial label for concentration. If unlisted please contact technical services. |
Shipping | The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below. |
Stability & Storage | Store at -80C. Avoid freeze-thaw cycles. |
Background: KRTAP17-1
Alternate Names
KAP17.1, keratin associated protein 16.1, keratin associated protein 17-1, keratin-associated protein 16.1, KRTAP16.1, KRTAP17.1
Gene Symbol
KRTAP17-1
Additional KRTAP17-1 Products
Product Documents for Recombinant Human KRTAP17-1 GST (N-Term) Protein
Product Specific Notices for Recombinant Human KRTAP17-1 GST (N-Term) Protein
This product is produced by and distributed for Abnova, a company based in Taiwan.
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.
Loading...
Loading...
Loading...
Loading...