Skip to main content

Lactoferrin Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-38885PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-38885PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LTF.

Source: E. coli

Amino Acid Sequence: PNHAVVSRMDKVERLKQVLLHQQAKFGRNGSDCPDKFCLFQSETKNLLFNDNTECLARLHGK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38885.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-38885PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: Lactoferrin

Lactoferrin is an iron binding glycoprotein with an approximate molecular weight of 80 kDa. The protein has two iron binding domains each housing one Fe3+ and the synergistic CO32- ion. The crystal structure form of human lactoferrin at 2.2A resolution exhibits 5330 protein atoms, 2Fe2+, 2CO32- and 98 carbohydrate atoms. Lactoferrin is absorbed from intestine by apical side of the membrane and localized to the nuclei. Intravenous infusion of lactoferrin is protective against lethal doses of E coli and induce bacterimia by a mechanism that downregulates neutrophil TNF alfa secretion. Recombinant human lactoferrin (rhLF), expressed and extracted from rice seed, is being evaluated for use as a dietary supplement to treat iron deficiency and/or iron deficiency induced anemia. Lactoferrin has been shown to have a role in the immune system and in early development of the embryo. A specific receptor for lactoferrin binding has been implicated in the human fetal intestine. Early embryonic localisation of lactoferrin by IHC has suggested its presence in various tissues including intestinal epitheliuem, kiney, and various regions of the brain.

Alternate Names

GIG12, HEL110, HLF2, Kaliocin-1, Lactoferricin, Lactoferroxin, Lactotransferrin, LF, LTF, Talalactoferrin

Gene Symbol

LTF

Additional Lactoferrin Products

Product Documents for Lactoferrin Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Lactoferrin Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...