LARS2 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-48830PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-48830PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

View all LARS2 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LARS2.

Source: E. coli

Amino Acid Sequence: VIKWERRVIPGCTRSIYSATGKWTKEYTLQTRKDVEKWWHQRIKEQASKISEADKSKPKFYVLSMFPYPSGKLHMGHVRVYTISD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-48830.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-48830PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: LARS2

LARS2, also known as Probable leucine--tRNA ligase, mitochondrial, is a 903 amino acid protein that is 102 kDa, catalyzes the aminoacylation of a specific tRNA or tRNA isoaccepting family with the cognate amino acid. Disease research is currently being performed with relation to LARS2 and rocky mountain spotted fever, specific phobia, spotted fever, phobia, lactic acidosis, mitochondrial encephalomyopathy, encephalomyopathy, neisseria meningitides, bipolar disorder, nasopharyngitis, pneumonia, schizophrenia, tuberculosis, malaria, and carcinoma. This protein has been shown to have interactions with 20 proteins including ICT1, SRPR, PMM2, NMNAT1, and NAF1 in tRNA aminoacylation, gene expression, mitochondrial tRNA aminoacylation, valine, leucine and isoleucine biosynthesis, and aminoacyl-tRNA biosynthesis pathways.

Alternate Names

EC 6.1.1, EC 6.1.1.4, KIAA0028leucine tRNA ligase 2, mitocondrial, leucine translase, Leucine--tRNA ligase, leucyl-tRNA synthetase 2, mitochondrial, LeuRS, MGC26121, probable leucyl-tRNA synthetase, mitochondrial

Gene Symbol

LARS2

Additional LARS2 Products

Product Documents for LARS2 Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for LARS2 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.