Skip to main content

Lipoprotein Lipase/LPL Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-58366PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-58366PEP

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Lipoprotein Lipase/LPL.

Source: E. coli

Amino Acid Sequence: DQRRDFIDIESKFALRTPEDTAEDTCHLIPGVAESVATCHFNHSSKTFMVIHGWTVTGMYESWVPKLVAALYKREPDSNVIVVDWLSRAQEHYPVSAGYTKLVGQDVARFINWMEEEFNYPLD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58366.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking tide related information and a protocol, click here.

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-58366PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: Lipoprotein Lipase/LPL

LPL, also known as Lipoprotein lipase, is a 475 amino acid that is 53 kDa, is a vascular lipase, but not synthesized in endothelial cells. It is anchored to the capillary endothelium by proteoglycans and acts as a catalyzer of triglycerides hydrolysis to release free fatty acids into the circulation and initiates the processing of triglyceride-rich lipoproteins such as chylomicrons and VLDL. It is being studied for its involvement in 150+ diseases and disorders including high density lipoprotein cholesterol level qtl 11, hyperlipoproteinemia, lipoprotein lipase deficiency, familial lipoprotein lipase deficiency, hyperlipoproteinemia type v, lipase deficiency combined, hyperlipoproteinemia type iii, glycogen storage disease, hyperlipidemia, hypertriglyceridemia, glucose intolerance, cetp deficiency, hypertension, fatty liver, nephrotic syndrome, kidney failure, and myocardial infarction. This protein has been shown to interact with 50 proteins including COPS6, PTPN4, RPL18A, ASCC2, KIAA1377 in developmental biology, transcriptional regulation of white adipocyte differentiation, lipid digestion, mobilization, and transport, metabolism, lipoprotein metabolism, glycerolipid metabolism, PPAR signaling pathway, and Alzheimer's disease pathways.

Alternate Names

LIPD, LPL

Gene Symbol

LPL

Additional Lipoprotein Lipase/LPL Products

Product Documents for Lipoprotein Lipase/LPL Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Lipoprotein Lipase/LPL Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...