Livin Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-56859PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-56859PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

View all Livin Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Livin.

Source: E. coli

Amino Acid Sequence: MGPKDSAKCLHRGPQPSHWAAGDGPTQERCGPRSLGSPVLGLDTCRAWDHVDGQILGQLRPLTEEEE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56859.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-56859PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: Livin

Livin (BIRC7/KIAP) is a member of the family of inhibitor of apoptosis proteins (IAP) and contains a single copy of a baculovirus IAP repeat (BIR) as well as a RING-type zinc finger domain (reviewed in Ma et al 2006 and Crnkovic-Mertens et al 2006). Resistance towards apoptosis is a hallmark of cancer cells, and overexpression of IAPs can contribute to the development of cancer though inhibiting apoptosis (reviewed in Wright et al. 2005). IAP proteins inhibit apoptosis by binding to and inhibiting caspases through their BIR domain(s). Some IAP members, like Liven, also have a RING-type finger motif at their carboxyl-terminal which may enhance anti-apoptotic activity. Many RING finger-containing IAPs possess E3 ubiquitin ligase activity, and it has been shown that Liven acts an E3 ubiquitin ligase for targeting the degradation of Smac/DIABLO. Smac/DIABLO functions by inhibiting IAP-caspase interactions, thereby promoting apoptosis. Thus degradation of Smac/DIABLO is thought to be a mechanism to enhance Livin anti-apoptotic activity, thereby promoting cell survival. Two splicing variants of Livin, alpha and beta, have been identified. The two isoforms are thought to have different anti-apoptotic properties; however, there are conflicting reports are to whether they actually differ in their biological activities. There is accumulating evidence that Liven plays a significant role in a spectrum of tumor types and it is thought that Liven may have potential as a diagnostic and prognostic tumor marker. Liven is expressed at low levels in adult tissues, and relatively higher levels in developmental tissues and in many cancer cells. Certain cancer patients develop autoantibodies against liven and in a number of cancers, Liven is detected only in the tumors but not, or to substantially lower levels, in the corresponding normal adjacent tissue. This antibody recognizes Livin, both isoform alpha and isoform beta. Human Livin isoform alpha is a 298 amino acid (aa) protein, GenBank no. NP_647478. Human Livin isoform beta is a 280 aa protien, GenBank no. NP_071444.1. The antibody will also recognize other isoforms of Livin that contain the peptide immunogen sequence.

Alternate Names

BIRC7, KIAP, ML-IAP

Gene Symbol

BIRC7

Additional Livin Products

Product Documents for Livin Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Livin Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.