Skip to main content

LKB1/STK11 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-87817PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-87817PEP

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human STK11.

Source: E. coli

Amino Acid Sequence: DSTEVIYQPRRKRAKLIGKYLMGDLLGEGSYGKVKEVLDSETLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLRHKNVIQLVDVLYNEEKQKMYMVMEYCVCGMQEMLDSVPEKRFPVCQ

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87817.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-87817PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: LKB1/STK11

Peutz-Jeghers syndrome (PJS) is a rare hereditary disease characterized by melanocytic macules lips, gastrointestinal hamartomatous polyps and an increased risk for many classes of cancer. LKB1 (also designated STK11 and PJS) has been identified as the gene mutated in PJS. LKB1 is a 433 amino acid Serine/Threonine kinase with strong homology to the Xenopus cytoplasmic protein kinase XEEK1 and weaker similarity to many other protein kinases. LKB1 is ubiquitously expressed and many frameshift, deletion and splicing mutations have been identified in PJS patients. Despite the increased risk of cancer for PJS patients, LKB1 does not appear to play a major role in colorectal, testicular or breast cancers.

Long Name

Serine/threonine Protein Kinase LKB1

Alternate Names

PJS, STK11

Gene Symbol

STK11

Additional LKB1/STK11 Products

Product Documents for LKB1/STK11 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for LKB1/STK11 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...