LYK5 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-89577PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-89577PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

View all LYK5 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human STRADA.

Source: E. coli

Amino Acid Sequence: MLLEKLNGTVPCLLDTSTIPAEELTMSPSRSVANSGLSDSLTTSTPRPSNGDSPSHPYHRTFSPHFHHFVEQCLQRNPDARPSASTLLNHSFFKQIKRRASEALPELLRPVTPITNFEGSQSQDHSG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89577.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-89577PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: LYK5

The protein encoded by the LYK5 gene contains a STE20-like kinase domain, but lacks several residues that are critical forcatalytic activity, so it is termed a 'pseudokinase'. The protein forms a heterotrimeric complex withserine/threonine kinase 11 (STK11, also known as LKB1) and the scaffolding protein calcium binding protein 39 (CAB39,also known as MO25). The protein activates STK11 leading to the phosphorylation of both proteins and excluding STK11from the nucleus. The protein is necessary for STK11-induced G1 cell cycle arrest. A mutation in this gene has beenshown to result in polyhydramnios, megalencephaly, and symptomatic epilepsy (PMSE) syndrome. Multiple transcriptvariants encoding different isoforms have been found for this gene. Additional transcript variants have been describedbut their full-length nature is not known. (provided by RefSeq)

Alternate Names

LYK5FLJ90524, NY-BR-96, protein kinase LYK5, Serologically defined breast cancer antigen NY-BR-96, STE20-like pseudokinase, STE20-related adapter protein, STE20-related adaptor protein, STE20-related kinase adapter protein alpha, STE20-related kinase adaptor alpha, Stlk, STRAD alpha, STRADPMSE

Gene Symbol

STRADA

Additional LYK5 Products

Product Documents for LYK5 Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for LYK5 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.