Recombinant Human Map17 GST (N-Term) Protein

Name: Recombinant Human Map17 GST (N-Term) Protein
Brand: Novus Biologicals
SKU: H00010158-P01

Novus Biologicals, part of Bio-Techne | Catalog # H00010158-P01

Submit a review

Product Datasheet / COA / SDS

100% Guarantee

Product Specifications
Scientific Data
Preparation & Storage
Background
Product Documents
Specific Notices

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

ELISA, Affinity Purification, Microarray, SDS-PAGE, Western Blot

View all Map17 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-114 of Human PDZK1IP1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MSALSLLILGLLTAVPPASCQQGLGNLQPWMQGLIAVAVFLVLVAIAFAVNHFWCQEEPEPAHMILTVGNKADGVLVGTDGRYSSMAASFRSSEHENAYENVPEEEGKVRSTPM

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

38.6 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human Map17 GST (N-Term) Protein

SDS-PAGE: Recombinant Human Map17 GST (N-Term) Protein [H00010158-P01]

SDS-Page: Recombinant Human Map17 Protein [H00010158-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation and Storage

H00010158-P01

Preparation Method	in vitro wheat germ expression system
Formulation	50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative	No Preservative
Concentration	Please see the vial label for concentration. If unlisted please contact technical services.
Shipping	The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage	Store at -80C. Avoid freeze-thaw cycles.

Background: Map17

Map17, also known as small PDZK1-associated protein (SPAP) is an endogenous regulator of cellular PDZK1 levels through the regulation of PDZK1 turnover. MAP17 is only expressed at significant levels in the proximal tubular epithelial cells of the kidney, and is diffusely expressed in various carcinomas originating from kidney, colon, lung and breast. MAP17 is thought to be associates with tumor formation, and MAP17 antibodies are useful for cancer research and protein turnover studies.

Alternate Names

17 kDa membrane-associated protein, DD96, MAP17epithelial protein up-regulated in carcinoma, membrane associated protein 17, membrane-associated protein 17, PDZK1 interacting protein 1, PDZK1-interacting protein 1, Protein DD96, RP1-18D14.5, SPAP

Gene Symbol

PDZK1IP1

Additional Map17 Products

Product Documents for Recombinant Human Map17 GST (N-Term) Protein

Product Datasheets

Download Product Datasheets

COA

SDS

Download SDS

Product Specific Notices for Recombinant Human Map17 GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Citations
Reviews