MGAT4B Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-17394PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-17394PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

View all MGAT4B Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MGAT4B

Source: E. coli

Amino Acid Sequence: VVDVYQREFLALRDRLHAAEQESLKRSKELNLVLDEIKRAVSERQALRDGDGNRTWGRLTEDPRLKPWNGSHRHVLHLPTVFHHLPHLLAKESSLQPAVRVGQGRTGVSVVMGIPSVRREVHSYLTDTLHSLISELSPQEKE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10-100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17394.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP3-17394PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: MGAT4B

MGAT4B, also known as Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase B, has 3 isoforms, a 548 amino acid isoform that is 63 kDa, a 547 amino acid isoform that is 63 kDa, and a 563 amino acid isoform that is 65 kDa; participates in the transfer of N-acetylglucosamine (GlcNAc) to the core mannose residues of N-linked glycans; acts as a catalyzer in the formation of the GlcNAcbeta1-4 branch on the GlcNAcbeta1-2Manalpha1-3 arm of the core structure of N-linked glycans; necessary for the production of tri- and tetra-antennary N-linked sugar chains, and it is not the main contributor in N-glycan biosynthesis. Disease research is currently being performed with relation to MGAT4B and immunodeficiency, pancreatic cancer, hepatocellular carcinoma, pancreatitis, interferon, carcinoma, and extrahepatic bile duct carcinoma. Interactions with this protein have been shown to involve LRSAM1, MGAT2, MGAT3, MGAT5, FUT8, and MGAT5B in N-glycan antennae elongation in the medial/trans-Golgi, transport to the Golgi and subsequent modification, asparagine N-linked glycosylation, N-Glycan antennae elongation, methabolism of proteins, N-Glycan biosynthesis, and metabolic pathways.

Alternate Names

alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase B, alpha-1,3-mannosyl-glycoprotein beta-1,4-N-acetylglucosaminyltransferase, aminyltransferase, EC 2.4.1.145, GlcNAc-T IVb, GNT-IV, GnT-Ivb, isoenzyme B, isozyme B, mannosyl (alpha-1,3-)-glycoprotein beta-1,4-N-acetylglucosaminyltransferase, N-acetylglucosaminyltransferase IVb, N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase IVb, UDP-N-acetylglucosamine: alpha-1,3-D-mannosidebeta-1,4-N-acetylglucosaminyltransferase IV, UDP-N-acetylglucosamine: alpha-1,3-D-mannosidebeta-1,4-N-acetylglucosaminyltransferase IVb

Gene Symbol

MGAT4B

Additional MGAT4B Products

Product Documents for MGAT4B Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for MGAT4B Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.