MKS1 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-88691PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-88691PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

View all MKS1 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MKS1.

Source: E. coli

Amino Acid Sequence: TCTTKSLAMDKVAHFSYPFTFEAFFLHEDESSDALPEWPVLYCEVLSLDFWQRYRVEGYGAVVLPATPGSHTLTVSTWRPVELGTVA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88691.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-88691PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: MKS1

MKPX, also known as JSP-1 for Jnk Stimulatory Phosphatase-1, belongs to the LMW-DSP subfamily of phosphatases. MKPX has been shown to have the capacity to activate the c-Jun N-terminal kinase (Jnk) signaling pathway. The activation of Jnk has been implicated in a number of important physiological processes, including embryonic morphogenesis, cell survival and apoptosis. At least two mRNA transcripts have been reported. Jnk signaling has been linked to human disease conditions, such as tumor development, cardiac hypertrophy, ischemia/reperfusion injury, diabetes, hyperglycemia-induced apoptosis, and several neurodegenerative disorders.MKPX has been shown to be widely expressed with highest expression in heart, kidney, liver, lung, pancreas and placenta. ESTs have been isolated from a diverse set of human tissues libraries, especially blood and breast.Caution: The acronym MKPX also has been used to describe Dual Specificity Protein Phosphatase 7.

Alternate Names

BBS13FLJ20345, FABB proteome-like protein, Meckel syndrome type 1 protein, Meckel syndrome, type 1, MES, MKS, POC12, POC12 centriolar protein homolog

Gene Symbol

MKS1

Additional MKS1 Products

Product Documents for MKS1 Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for MKS1 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.