MTMR12 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-13625PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-13625PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

View all MTMR12 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MTMR12.

Source: E. coli

Amino Acid Sequence: RPEEIHTNEKEVTEKEVTLHLLPGEQLLCEASTVLKYVQEDSCQHGVYGRLVCTDFKIAFLGDDESALDNDETQFKNKVIGENDITLHCVDQIYGVFDE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-13625.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-13625PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: MTMR12

MTMR12, also known as Myotubularin-related protein 12, has 3 isoforms, a 747 amino acid isoform that is 86 kDa, a 693 amino acid isoform that is 80 kda and a 637 amino acid isoform that is 73 kDa, cytoplasm located, ubiquitous with prominent expression in brain, heart, kidney, placenta, and lung; acts as an adaptor subunit in a complex with an active PtdIns(3)P 3-phosphatase for the phosphatase myotubularin to regulate myotubularin intracellular location. Current research is being performed on this protein involvement in cri-u-chat syndrome, cervix uteri carcinoma in situ, pelvic inflammatory disease, centronuclear myopathy, gonorrhea, myopathy, and carcinoma. This protein has shown an interaction with MTMR2, MTM1, KBTBD7, and UBC proteins.

Alternate Names

3-PAP3PAP, 3-phosphatase adapter subunit, KIAA1682FLJ20476, myotubularin related protein 12, myotubularin-related protein 12,3-phosphatase adapter protein, Phosphatidylinositol-3 phosphate 3-phosphatase adapter subunit, phosphatidylinositol-3 phosphate 3-phosphatase adaptor subunit, phosphatidylinositol-3-phosphate associated protein, PIP3AP

Gene Symbol

MTMR12

Additional MTMR12 Products

Product Documents for MTMR12 Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for MTMR12 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.