MTR Antibody Blocking Peptide

Name: MTR Antibody Blocking Peptide
Brand: Novus Biologicals
SKU: NBP1-79285PEP

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-79285PEP

Submit a review

Product Datasheet / COA

100% Guarantee

Product Specifications
Preparation & Storage
Background
Product Documents
Specific Notices

Key Product Details

Source

Synthetic

Conjugate

Unconjugated

Applications

Antibody Competition, Immunohistochemistry, Western Blot

View all MTR Proteins and Enzymes »

Product Specifications

Description

A human MTR antibody blocking peptide.

Source: Synthetic

Amino Acid Sequence: (Accession #: NP_000245) GSEQLDVADLRRLRYKGIRPAPGYPSQPDHTEKLTMWRLADIEQSTGIRL

For longer periods of storage, aliquot and store at -20C. Avoid repeat freeze-thaw cycles.

Purity

N/A

Application Notes

This peptide is useful as a blocking peptide for NBP1-79285. This synthetic peptide is designed for use in an antibody competition assay with its corresponding antibody. Use of this product in any other assay has not yet been tested.

For further blocking peptide related protocol, click here.

Protein / Peptide Type

Antibody Blocking Peptide

Formulation, Preparation and Storage

NBP1-79285PEP

Formulation	Lyophilized from sterile distilled water.
Preservative	No Preservative
Concentration	Lyoph
Reconstitution	Reconstitute with 100 uL of sterile PBS for a final peptide concentration of 1 mg/mL.
Shipping	The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage	Store at -20C. Avoid freeze-thaw cycles.

Background: MTR

MTR is the enzyme 5-methyltetrahydrofolate-homocysteine methyltransferase. This enzyme, also known as cobalamin-dependent methionine synthase, catalyzes the final step in methionine biosynthesis. Mutations in MTR have been identified as the underlying cause of methylcobalamin deficiency complementation group G. MTR encodes the enzyme 5-methyltetrahydrofolate-homocysteine methyltransferase. This enzyme, also known as cobalamin-dependent methionine synthase, catalyzes the final step in methionine biosynthesis. Mutations in MTR have been identified as the underlying cause of methylcobalamin deficiency complementation group G. Sequence Note: This RefSeq record was created from transcript and genomic sequence data because no single transcript was available for the full length of the gene. The extent of this transcript is supported by transcript alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Alternate Names

5-methyltetrahydrofolate-homocysteine methyltransferase, 5-methyltetrahydrofolate-homocysteine methyltransferase 1, cblG, cobalamin-dependent methionine synthase, EC 2.1.1.13, FLJ33168, FLJ43216,5-methyltetrahydrofolate--homocysteine methyltransferase, FLJ45386, methionine synthase, MS, Vitamin-B12 dependent methionine synthase

Gene Symbol

MTR

Additional MTR Products

Product Documents for MTR Antibody Blocking Peptide

Product Datasheets

Download Product Datasheets

COA

Product Specific Notices for MTR Antibody Blocking Peptide

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Citations
Reviews