Skip to main content

MYBPC1 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-86427PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-86427PEP

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MYBPC1.

Source: E. coli

Amino Acid Sequence: DWTLVETPPGEEQAKQNANSQLSILFIEKPQGGTVKVGEDITFIAKVKAEDLLRKPTIKWFKGKWMDLASKAGKHLQLKETFERHSRVYTFEMQIIKAKDNFAGNYRCEVTYKDKFDSCSFDLEVHESTGTTPN

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86427.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-86427PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: MYBPC1

MYBPC1, also known as Myosin-binding protein C, slow-type, is a protein with 10 isoforms ranging from a 1,120 amino acid isoform that is 126 kDa to a 1,173 amino acid isoform that is 131 kDa, located in the crossbridge region of vertebrate striated muscle a bands, plays an important role in muscle contraction by recruiting muscle-type creatine kinase to myosin filaments and modifies the activity of actin-activated myosin ATPase. Studies are being performed on the relationship of this protein to distal arthrogryposis, urethral intrinsic sphincter deficiency, akinetic mutism, hypertrophic cardiomyopathy, familial hypertrophic cardiomyopathy, dilated cardiomyopathy, dysgraphia, laryngeal squamous cell carcinoma, fg syndrome, atrial fibrillation, squamous cell carcinoma, mutism, muscular dystrophy, urethritis, polymyositis, laryngitis, dermatomyositis, myositis, distal arthrogryposis, and urethral intrinsic sphincter deficiency. MYBPC1 protein involvement has been observed with relation to CALM1, CALM2, CALM3, FHL1, MYBPC2, USP25, TTN, DYSF, ACTN2, and more than 30 other proteins in the muscle contraction and striated muscle contraction pathways.

Alternate Names

C-protein, skeletal muscle slow isoform, MYBPCC, MYBPCS, myosin binding protein C, slow type, myosin-binding protein C, slow-type, skeletal muscle C-protein, Slow MyBP-C, slow-type

Gene Symbol

MYBPC1

Additional MYBPC1 Products

Product Documents for MYBPC1 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for MYBPC1 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...