MYH7 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-52737PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-52737PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

View all MYH7 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MYH7.

Source: E. coli

Amino Acid Sequence: ALRKKHADSVAELGEQIDNLQRVKQKLEKEKSEFKLELDDVTSNMEQIIKAKANLEKMCRTLEDQMNEHRSKAEETQRSVNDLTSQRAKLQTENGELSRQLDEKEALISQLTRGKLTYTQQLEDLKRQLEEEVKAKNALAHALQS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52737.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking tide related information and a protocol, click here.

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-52737PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: MYH7

MYH7, also known as Myosin-7, is a 1,935 amino acid protein that is 223 kDa, found predominantly in myocytes and mediates plus-ended movement along microfilaments, it is involved in muscle contraction through cyclic interactions with actin-rich thin filaments, creating a contractile force. It is regulated by phosphorylation via myosin light chain kinase (MLCK) and by intracellular Ca2+ concentrations. Disease research is currently being studied with relation to this protein and myopathy, hypertrophic cardiomyopathy, familial hypertrophic cardiomyopathy, dilated cardiomyopathy, wolff-parkinson-white syndrome, left ventricular noncompaction, left ventricular noncompaction 5, long qt syndrome, endocardial fibroelastosis, scapuloperoneal syndrome, laing distal myopathy, rhabdomyosarcoma oculopharyngeal muscular dystrophy, ebstein anomaly, acute myocardial infarction, muscular dystrophy, myotonic dystrophy, and myocardial infarction. Its involvement has been observed with relation to YWHAQ, MYH13, MYL3, YWHAZ, MYH9, ACTB, NTHL1, and over 100 other proteins in cell adhesion integrin-mediated cell adhesion and migration, cell adhesion tight junctions, cytoskeleton remodeling regulation of actin cytoskeleton by Rho GTPases, immune response CCR3 signaling in eosinophils, development MAG-dependent inhibition of neurite outgrowth, RhoA pathway, factors promoting cardiogenesis in vertebrates, antioxidant action of vitamin-C, transendothelial migration of leukocytes, actin nucleation by ARP-WASP complex, cardiac muscle contraction, hypertrophic cardiomyopathy (HCM), dilated cardiomyopathy, and viral myocarditis pathways.

Long Name

Myosin Heavy Chain 7, Cardiac Muscle, Beta

Alternate Names

CMD1S, CMH1, MPD1, MYHCB, Myosin-7, SPMD, SPMM

Gene Symbol

MYH7

Additional MYH7 Products

Product Documents for MYH7 Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for MYH7 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.