Skip to main content

MYL7 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-81016PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-81016PEP

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MYL7.

Source: E. coli

Amino Acid Sequence: DPEEAILSAFRMFDPSGKGVVNKDEFKQLLLTQADKFSPAEVEQMFALTPMDLAGNIDYKSLCYIITHGDEK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-81016.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-81016PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: MYL7

Myosins are a large family of motor proteins that share the common features of ATP hydrolysis, actin binding andpotential for kinetic energy transduction. Originally isolated from muscle cells (hence the name), almost alleukaryotic cells are now known to contain myosins. Structurally, mysoins contain a head domain that binds to actinfilaments (microfilaments) and is the site of ATP hydrolysis. The tail domain interacts with cargo molecules, and theneck acts as a linker between the head and tail and is the site of regulatory myosin light chain binding. There are 17myosin families and the most well characterized is myosin II. Myosin II is found predominantly in myocytes andmediates plus-ended movement along microfilaments. It is involved in muscle contraction through cyclic interactionswith actin-rich thin filaments, creating a contractile force. It is regulated by phosphorylation via myosin lightchain kinase (MLCK) and by intracellular Ca2+ concentrations.

Alternate Names

atrial isoform, light polypeptide 7, regulatory, MLC-2a, MYL2A, MYLC2AMLC2a, myosin, light chain 7, regulatory

Gene Symbol

MYL7

Additional MYL7 Products

Product Documents for MYL7 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for MYL7 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...