Nab2 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-82804PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-82804PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

View all Nab2 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NAB2.

Source: E. coli

Amino Acid Sequence: HPEELGGPPLKKLKQEVGEQSHPEIQQPPPGPESYVPPYRPSLEEDSASLSGESLDGHLQAVGSCPRLTPPPADLPLALPAHGLWSRHILQQTLMDEGLRLARLVSHDRVGRLSPCVPAKPPLAEFEEGLLDRCPAPGPH

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-82804.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-82804PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: Nab2

Transcriptional control is in part regulated by interactions between DNA-bound transcription factors, such as Egr-1/NGFI-A, and coregulatory proteins, such as NAB (for NGFI-A-binding proteins). The evolutionarily conserved NAB proteins, NAB1 and NAB2, are corepressors of EGF-1/NGFI-A. Both NAB1 and NAB2 contain an amino terminal NAB conserved domain 1 (NCB1), which is required for binding NGFI-A, and a carboxy terminal NCD2 domain, which is responsible for the repressor function of NAB proteins. NAB2 is principally localized in the nucleus and may play a role in the downregulation of NGFI-A activity as well as in controlling fundamental processes such as cell division, differentiation and apoptosis. NAB2 has a predicted molecular mass of 56 kDa and localizes to chromosome 12q13.3-14.1, a region that is rearranged in several solid tumors, lipomas and liposarcomas.

Alternate Names

EGR-1-binding protein 2, MADEREGR1 binding protein 2, Melanoma-associated delayed early response protein, MGC75085, NGFI-A binding protein 2 (EGR1 binding protein 2), NGFI-A-binding protein 2, Protein MADER

Gene Symbol

NAB2

Additional Nab2 Products

Product Documents for Nab2 Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Nab2 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.