Nardilysin Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-58484PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-58484PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

View all Nardilysin Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Nardilysin.

Source: E. coli

Amino Acid Sequence: LVNWFKAHRGPGSKMLSVHVVGYGKYELEEDGTPSSEDSNSSCEVMQLTYLPTSPLLADCIIPITDIRAFT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58484.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-58484PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: Nardilysin

NRD1, also known as Nardilysin, has 2 isoforms, a 1,150 amino acid isoform1 that is 132 kDa and a 1,218 amino acid isoform2 that is 139 kDa, primarily found in adult heart, skeletal muscle, and testis, it is a member of the peptidase M16 family, and slices peptide substrates at the N-terminus of arginine residues in dibasic moieties. Disease research is being performed in relation to NRD1 and differentiating neuroblastoma, Down syndrome, Alzheimer's disease, neuroblastoma, prostatitis, neuronitis, and alcoholism. Interactions with NRD1 protein have been shown to involve TP53, HBEGF, CALCA, MYC, FBXW11, and more than 50 other proteins in proteolysis, neuromuscular junction development, cell proliferation, cell migration, and positive regulation of membrane protein ectodomain proteolysis processes.

Alternate Names

EC 3.4.24, EC 3.4.24.61, hNRD1, hNRD2, nardilysin, nardilysin (N-arginine dibasic convertase), N-arginine dibasic convertase, NRD convertase, NRD-C

Gene Symbol

NRDC

Additional Nardilysin Products

Product Documents for Nardilysin Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Nardilysin Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.