Skip to main content

NDUFA9 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-13646PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-13646PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NDUFA9.

Source: E. coli

Amino Acid Sequence: RVLSMSRSAITAIATSVCHGPPCRQLHHALMPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDKYDIMHLRPMGDLGQLLFLEWDARDKDSIRRVVQHSNVVINLIGRDWETKNFDFEDVFVKIPQAI

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-13646.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-13646PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: NDUFA9

ATP is generated via oxidative phosphorylation (Oxphos) in the mitochondria of almost all cells. The protein components of Oxphos, 4 respiratory chain complexes (I-IV) and an ATP synthase, are encoded in both the mitochondrial and nuclear genomes. Of the 4 respiratory chain complexes, complex I is the largest at 900 kD and contains at least 41 polypeptide subunits, 7 of which are encoded in the mitochondria, the remaining subunits are encoded in the nucleus. The multisubunit NADH:ubiquinone oxidoreductase is the first enzyme complex. By use of chaotropic agents, complex I can be fragmented into 3 different fractions. The flavoprotein fraction contains the NDUFV1, NDUFV2, and NDUFV3 subunits. The iron-sulfur protein (IP) fraction contains at least 7 subunits, NDUFS1-NDUFS6 and NDUFA5. The remaining subunits are part of the hydrophobic protein (HP) fraction. NDUFA9 is part of the hydrophobic protein fraction of the enzyme complex. However, it is predominantly hydrophilic, and appears to lie mostly outside the lipid bilayer.

Alternate Names

CC6, CI39k, CI-39k, CI-39kD, complex I 39kDa subunit, Complex I-39kD, MGC111043, NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9 (39kD), NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa, NADH dehydrogenase (ubiquinone) Fe-S protein 2-like (NADH-coenzyme Q reductase), NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial, NADH-ubiquinone oxidoreductase 39 kDa subunit, NDUFS2L, SDR22E1, short chain dehydrogenase/reductase family 22E, member 1

Gene Symbol

NDUFA9

Additional NDUFA9 Products

Product Documents for NDUFA9 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for NDUFA9 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...