Skip to main content

NEK4 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-82528PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-82528PEP

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NEK4.

Source: E. coli

Amino Acid Sequence: VAGECIIEKQGRIHPDLQPHNSGSEPSLSRQRRQKRREQTEHRGEKRQVRRDLFAFQESPPRFLPSHPIVGKVDVTSTQKEAENQRRVVTGSVSSSRSSEMSSSKDRPLSARERRRLKQSQEEMSSSGPSVRKASLSVAGPGKPQEEDQP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-82528.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-82528PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: NEK4

Belonging to the NEK Ser/Thr protein kinase family, NEK4 plays a significant role in the cell cycle, cell division, mitosis and protein phosphorylation process. More specifically, NEK4 can be found in the nucleus, and acts exclusively upon threonine residues. Molecular Functions of NEK4 include ATP binding, metal ion binding and protein serine/threonine kinase activity. Common diseases for NEK4 include adenocarcinoma, cancer, polycystic ovary syndrome, epithelial neoplasia, coffin-lowry syndrome, bipolar disorder, retinitis and malaria.

Alternate Names

EC 2.7.11, Never in mitosis A-related kinase 4, NIMA (never in mitosis gene a)-related kinase 4, NimA-related protein kinase 4, NRK2EC 2.7.11.1, pp12301, serine/threonine kinase 2, serine/threonine protein kinase-2, Serine/threonine-protein kinase 2, serine/threonine-protein kinase Nek4, Serine/threonine-protein kinase NRK2, STK2MGC33171

Gene Symbol

NEK4

Additional NEK4 Products

Product Documents for NEK4 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for NEK4 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...