Skip to main content

Neuroglycan C/CSPG5 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-58590PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-58590PEP

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Neuroglycan C/CSPG5.

Source: E. coli

Amino Acid Sequence: SLSTIAEGSHPNVRKLCNTPRTSSPHARALAHYDNVICQDDPSAPHKIQEVLKSCLKEEESFNIQNSMSPKLEGGKGDQADLDVNCL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58590.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-58590PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: Neuroglycan C/CSPG5

Many cellular activities depend on the interaction of cells with the surrounding extracellular matrix (ECM). Most cells, in intact tissue and in culture, are attached to an ECM. Epithelial cells are associated with the basement membrane; fibroblastic cells are usually embedded in a pericellular mesh of fibrils, and tissue culture cells usually grow on a substrate which is covered by various ECM components. Studies have indicated that the matrix or its various isolated components provide not only adhesive surfaces for cells to grow on but also have effects on the rate of cell growth, mobility, morphogenesis and differentiation. Within the ECM several glycoproteins and proteoglycans have been identified. It has been proposed that the different constituents interact with each other in a rather complex fashion. The poor antigenicity of proteoglycans especially their glycoaminoglycan (GAG) moieties make it difficult to localize these molecules in tissue and cell culture. Monoclonal Anti-Chondroitin Sulfate can be used to study chondroitin sulfate proteoglycan (CSPG) distribution and its relationships to specific cell-substrate contacts.

Alternate Names

CALEB, CSPG5, NGC

Gene Symbol

CSPG5

Additional Neuroglycan C/CSPG5 Products

Product Documents for Neuroglycan C/CSPG5 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Neuroglycan C/CSPG5 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...