Skip to main content

NFKBIL2 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-48847PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-48847PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NFKBIL2.

Source: E. coli

Amino Acid Sequence: IRVRVQVQDHLFLIPVPHSSDTHSVAWLAEQAAQRYYQTCGLLPRLTLRKEGALLAPQDLIPDVLQSNDEVLAEVTSWDLPPLTDRYRRACQSLGQGEHQQVLQAVELQGLGLSFSACSLALDQAQLTPLLRALKLHT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-48847.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-48847PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: NFKBIL2

Sharing some sequence similarities with IKBKB, NF-kappa-B inhibitor-like protein 2 (NFKBIL2) belongs to the Tonsoku family. Also known as TONSL, the protein encoded by this gene may bind NF-kappa-B complex and trap them in the cytoplasm, preventing them from entering the nucleus and interacting with the DNA. Additionally, NFKBIL2 is a component of the MMS22L-TONSL complex. Used during DNA replication, this complex is essential for promoting homologous recombination repair of replication fork double strand breaks. NFKBIL2 is known to interact with MMS22L, MCM4, SSRP1, GSK3B and MCM2. Diseases associated with this gene include t-cell leukemia, psoriasis, breast cancer, atherosclerosis, leukemia and immunodeficiency.

Alternate Names

IkappaBR, I-kappa-B-related protein, IKBRFLJ40087, Inhibitor of kappa B-related protein, NF-kappa-B inhibitor-like protein 2, NFKBIL2tonsoku-like protein, Nuclear factor of kappa light polypeptide gene enhancer in B-cellsinhibitor-like 2ikappaBR, tonsoku-like, DNA repair protein

Gene Symbol

TONSL

Additional NFKBIL2 Products

Product Documents for NFKBIL2 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for NFKBIL2 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...