NFYA Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-48977PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-48977PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

View all NFYA Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NFYA.

Source: E. coli

Amino Acid Sequence: ANTNTTSSGQGTVTVTLPVAGNVVNSGGMVMMVPGAGSVPAIQRIPLPGAEMLEEEPLYVNAKQYHRILKRRQARAKLEAEGKIPKERRKYLHESRHRHAMARKRGEGGRFFSPKEKDSPHMQDPNQADEE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-48977.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-48977PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: NFYA

The Y box is a CCAAT box which is bound by the heteromeric DNA binding protein, NFY (also known as CBF and CP1). Unlike the transcription factors C/EBP and CTF/NF1 which also bind CCAAT like sequences, NFY exhibits a strict binding requirement for this pentanucleotide sequence. Binding sites for this factor have been described for nearly 30% of all eukaryotic genes. Y/CCAAT sequences were frequently observed in the promoter proximal sequences. NF-Y is composed of 3 separate subunits (A,B and C) each of which is required for DNA binding. Each subunit has remained highly conserved throughout evolution. In fact, homologous yeast subunits can substitute for mammalian NF-Y in DNA-binding assays. The conserved core sequences of NF-YB and NF-YC contain a 70 aa region similar to the histone fold motif of nucleosomes H2A and H2B. The unique structure and evolutionary conservation of this transcription factor suggests that it plays a fundamental role in the readout of eukaryotic genetic information.

Alternate Names

CAAT box DNA-binding protein subunit A, CBF-A, CBF-B, CCAAT-binding transcription factor subunit B, FLJ11236, HAP2, HAP2 CCAAT-binding protein, NF-YACAAT-box DNA binding protein subunit A, Nuclear transcription factor Y subunit A, nuclear transcription factor Y subunit alpha, nuclear transcription factor Y, alpha, Transcription factor NF-Y, A subunit

Gene Symbol

NFYA

Additional NFYA Products

Product Documents for NFYA Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for NFYA Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.