Recombinant Human Nicotinic Acetylcholine Receptor beta 2 GST (N-Term) Protein
Novus Biologicals, part of Bio-Techne | Catalog # H00001141-Q01
Key Product Details
Source
Wheat germ
Tag
GST (N-Term)
Conjugate
Unconjugated
Applications
ELISA, Affinity Purification, Microarray, Western Blot
Product Specifications
Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 26-130 of Human Nicotinic Acetylcholine Receptor beta 2
Source: Wheat Germ (in vitro)
Amino Acid Sequence: TDTEERLVEHLLDPSRYNKLIRPATNGSELVTVQLMVSLAQLISVHEREQIMTTNVWLTQEWEDYRLTWKPEEFDNMKKVRLPSKHIWLPDVVLYNNADGMYEVS
Purity
>80% by SDS-PAGE and Coomassie blue staining
Predicted Molecular Mass
37.29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Activity
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Protein / Peptide Type
Recombinant Protein
Scientific Data Images
12.5% SDS-PAGE Stained with Coomassie Blue.
Formulation, Preparation and Storage
H00001141-Q01
| Preparation Method | in vitro wheat germ expression system |
| Formulation | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
| Preservative | No Preservative |
| Concentration | Please see the vial label for concentration. If unlisted please contact technical services. |
| Shipping | The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below. |
| Stability & Storage | Store at -80C. Avoid freeze-thaw cycles. |
Background: Nicotinic Acetylcholine R beta 2/CHRNB2
Long Name
Nicotinic Acetylcholine Receptor beta 2
Alternate Names
Cholinergic Receptor Nicotinic Beta 2 Subunit, CHRNB2, EFNL3, NAChRB2, Neuronal Nicotinic Acetylcholine R beta 2
Gene Symbol
CHRNB2
Additional Nicotinic Acetylcholine R beta 2/CHRNB2 Products
- All Products for Nicotinic Acetylcholine R beta 2/CHRNB2
- Nicotinic Acetylcholine R beta 2/CHRNB2 cDNA Clones
- Nicotinic Acetylcholine R beta 2/CHRNB2 ELISA Kits
- Nicotinic Acetylcholine R beta 2/CHRNB2 Lysates
- Nicotinic Acetylcholine R beta 2/CHRNB2 Primary Antibodies
- Nicotinic Acetylcholine R beta 2/CHRNB2 Proteins and Enzymes
Product Specific Notices
This product is produced by and distributed for Abnova, a company based in Taiwan.
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.
Loading...
Loading...
Loading...
Loading...