nNOS Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-58114PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-58114PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

View all nNOS Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human nNOS.

Source: E. coli

Amino Acid Sequence: LVDLSYDSALEVLRGIASETHVVLILRGPEGFTTHLETTFTGDGTPKTIRVTQPLGPPTKAVDLSHQPPAGKEQPLAV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58114.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking tide related information and a protocol, click here.

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-58114PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: nNOS

NOS (nitric oxide synathase) is a mediator of NO (nitric oxide) production, an inorganic gaseous messenger between cells. In cells, NOS catalyzes the oxidization of L-arginine to produce L-citrulline and NO. Three isoforms of NOS has been identified (eNOS, iNOS, and nNOS) with all of them having binding sites for NADPH, FAD, FMN, and tetrahydrobiopterin (1). Specifically, nNOS (Neuronal nitric oxide synthase bNOS, cNOS, Type I) is bound to PSD95 located in the neuronal membrane and at increased level of Ca2+, nNOS is trasnlocated to cytoplasm. In cytoplasm, nNOS is dephosphorylated by calcineurin which initiates NO production (2). A phosphorylation by PKA and PKC on nNOS leads down-regulation of NO production.

Long Name

Neuronal Nitric Oxide Synthase

Alternate Names

NOS1

Gene Symbol

NOS1

Additional nNOS Products

Product Documents for nNOS Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for nNOS Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.