Recombinant Human Nse2 GST (N-Term) Protein

Name: Recombinant Human Nse2 GST (N-Term) Protein
Brand: Novus Biologicals
SKU: H00286053-P01

Novus Biologicals, part of Bio-Techne | Catalog # H00286053-P01

Submit a review

Citations (1)

Product Datasheet / COA / SDS

100% Guarantee

Product Specifications
Scientific Data
Preparation & Storage
Background
Product Documents
Specific Notices

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

ELISA, Affinity Purification, Microarray, SDS-PAGE, Western Blot

View all Nse2 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-247 of Human NSMCE2

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MPGRSSSNSGSTGFISFSGVESALSSLKNFQACINSGMDTASSVALDLVESQTEVSSEYSMDKAMVEFATLDRQLNHYVKAVQSTINHVKEERPEKIPDLKLLVEKKFLALQSKNSDADFQNNEKFVQFKQQLKELKKQCGLQADREADGTEGVDEDIIVTQSQTNFTCPITKEEMKKPVKNKVCGHTYEEDAIVRMIESRQKRKKKAYCPQIGCSHTDIRKSDLIQDEALRRAIENHNKKRHRHSE

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

54.3 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human Nse2 GST (N-Term) Protein

SDS-PAGE: Recombinant Human Nse2 GST (N-Term) Protein [H00286053-P01]

SDS-Page: Recombinant Human Nse2 Protein [H00286053-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation and Storage

H00286053-P01

Preparation Method	in vitro wheat germ expression system
Formulation	50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative	No Preservative
Concentration	Please see the vial label for concentration. If unlisted please contact technical services.
Shipping	The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage	Store at -80C. Avoid freeze-thaw cycles.

Background: Nse2

E3 SUMO-protein ligase component of the SMC5-SMC6 complex, a complex involved in DNA double-strand breaks byhomologous recombination. The complex may promote sister chromatid homologous recombination by recruiting theSMC1-SMC3 cohesin complex to double-strand breaks. Acts as a E3 ligase mediating SUMO attachment to various proteinssuch as SMC6L1 and TRAX, and maybe the cohesin components RAD21 and STAG2. SUMO protein-ligase activity is requiredfor the prevention of DNA damage-induced apoptosis by facilitating DNA repair

Alternate Names

C8orf36, E3 SUMO-protein ligase NSE2, EC 6.3.2, EC 6.3.2.-, FLJ32440, hMMS21, methyl methanesulfonate sensitivity gene 21, MMS21 homolog, MMS21chromosome 8 open reading frame 36, Non-SMC element 2 homolog, non-SMC element 2 homolog (MMS21, S. cerevisiae), non-SMC element 2, MMS21 homolog (S. cerevisiae), Non-structural maintenance of chromosomes element 2 homolog, NSE2

Gene Symbol

NSMCE2

Additional Nse2 Products

Product Documents for Recombinant Human Nse2 GST (N-Term) Protein

Product Datasheets

Download Product Datasheets

COA

SDS

Download SDS

Product Specific Notices for Recombinant Human Nse2 GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Citations
Reviews