Skip to main content

NSP 5 alpha 3 alpha Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-17187PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP3-17187PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NSP 5 alpha 3 alpha

Source: E. coli

Amino Acid Sequence: MRSAAKPWNPAIRAGGHGPDRVRPLPAASSGMKSSKSSTSLAFESRLSRLKRASSEDTLNKPGSTAASGVVRLKKTATAGAISELTESRLRSGTGAFTTTKRT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10-100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17187.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP3-17187PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: NSP 5 alpha 3 alpha

NSP 5alpha 3alpha is a novel structure protein with potential roles in ribosome biogenesis and rRNA metabolism/processing. NSP5a3a is highly expressed in certain tumor cell lines, and may serve as a good tumor marker. In these cancer lines, NSP5a3a has been shown to interact with the nucleolar apoptosis protein B23 and may be involved in a novel p73 dependent apoptosis mechanism. Therefore, NSP5a3a is expected to become an important potential target for future cancer treatment research.

Alternate Names

cytospin-B, CYTSBcytospin B, FLJ36955, HCMOGT-1, NSP, NSP5, Nuclear structure protein 5, sperm antigen HCMOGT 1, Sperm antigen HCMOGT-1, sperm antigen with calponin homology and coiled coil domains 1, sperm antigen with calponin homology and coiled-coil domains 1cytokinesis and spindle organization B, sperm antigen with calponin-like and coiled coil domains 1, structure protein NSP5a3a, structure protein NSP5a3b, structure protein NSP5b3a, structure protein NSP5b3b

Gene Symbol

SPECC1

Additional NSP 5 alpha 3 alpha Products

Product Documents for NSP 5 alpha 3 alpha Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for NSP 5 alpha 3 alpha Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...