Recombinant Human NUFIP1 GST (N-Term) Protein

Name: Recombinant Human NUFIP1 GST (N-Term) Protein
Brand: Novus Biologicals
SKU: H00026747-P01

Novus Biologicals, part of Bio-Techne | Catalog # H00026747-P01

Submit a review

Product Datasheet / COA / SDS

Discontinued Product

H00026747-P01 has been discontinued. View all NUFIP1 products.

Product Specifications
Scientific Data
Preparation & Storage
Background
Product Documents
Specific Notices

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

ELISA, Affinity Purification, Microarray, Western Blot

View all NUFIP1 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-276 of Human NUFIP1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MHAPGMKKIKLDTPEEIARWREERRKNYPTLANIERKKKLKLEKEKRGAVLTTTQYGKMKGMSRHSQMAKIRSPGKNHKWKNDNSRQRAVTGSGSHLCDLKLEGPPEANADPLGVLINSDSESDKEEKPQHSVIPKEVTPALCSLMSSYGSLSGSESEPEETPIKTEADVLAENQVLDSSAPKSPSQDVKATVRNFSEAKSENRKKSFEKTNPKRKKDYHNYQTLFEPRTHHPYLLEMLLAPDIRHERNVILQCVRYIIKKDFFGLDTNSAKSKDV

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

57.8 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human NUFIP1 GST (N-Term) Protein

12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation and Storage

H00026747-P01

Preparation Method	in vitro wheat germ expression system
Formulation	50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative	No Preservative
Concentration	Please see the vial label for concentration. If unlisted please contact technical services.
Shipping	The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage	Store at -80C. Avoid freeze-thaw cycles.

Background: NUFIP1

NUFIP1, also known as Nuclear fragile X mental retardation-interacting protein 1, is a 495 amino acid protein that is 56 kDa, binds RNA, contains a C2H2 zinc finger motif and a nuclear localization signal, it is associated with the nuclear matrix in perichromatin fibrils and, in neurons, localizes to the cytoplasm in association with endoplasmic reticulum ribosomes. Current research is being performed on several diseases and disorders including intellectual disability, neuronitis, microcephaly, and prostatitis. This protein has been shown to have interactions with YWHAZ, BRCA1, CCNT1, RUVBL2, FMR1, and over 30 other proteins in box C/D snoRNP assembly, RNA processing, and positive regulation of transcription from RNA polymerase II promoter pathways.

Alternate Names

bA540M5.1, nuclear fragile X mental retardation protein interacting protein 1, nuclear fragile X mental retardation protein-interacting protein 1, nuclear fragile X mental retardation-interacting protein 1, NUFIP, NUFIPNuclear FMRP-interacting protein 1

Gene Symbol

NUFIP1

Additional NUFIP1 Products

Product Documents for Recombinant Human NUFIP1 GST (N-Term) Protein

Product Datasheets

Download Product Datasheets

COA

SDS

Download SDS

Product Specific Notices for Recombinant Human NUFIP1 GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Citations
Reviews