Recombinant Human Nurr1/NGFI-B beta/NR4A2 GST (N-Term) Protein

Name: Recombinant Human Nurr1/NGFI-B beta/NR4A2 GST (N-Term) Protein
Brand: Novus Biologicals
SKU: H00004929-Q01

Novus Biologicals, part of Bio-Techne | Catalog # H00004929-Q01

Submit a review

Product Datasheet / COA / SDS

100% Guarantee

Product Specifications
Scientific Data
Preparation & Storage
Background
Product Documents
Specific Notices

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

ELISA, Affinity Purification, Microarray, SDS-PAGE, Western Blot

View all Nurr1/NGFI-B beta/NR4A2 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 71-170 of Human Nurr1/NGFI-B beta/NR4A2

Source: Wheat Germ (in vitro)

Amino Acid Sequence: GFQVQHSPMWDDPGSLHNFHQNYVATTHMIEQRKTPVSRLSLFSFKQSPPGTPVSSCQMRFDGPLHVPMNPEPAGSHHVVDGQTFAVPNPIRKPASMGFP

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

36.63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human Nurr1/NGFI-B beta/NR4A2 GST (N-Term) Protein

SDS-PAGE: Recombinant Human Nurr1/NGFI-B beta/NR4A2 GST (N-Term) Protein [H00004929-Q01]

SDS-Page: Recombinant Human Nurr1/NGFI-B beta/NR4A2 Protein [H00004929-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation and Storage

H00004929-Q01

Preparation Method	in vitro wheat germ expression system
Formulation	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative	No Preservative
Concentration	Please see the vial label for concentration. If unlisted please contact technical services.
Shipping	The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage	Store at -80C. Avoid freeze-thaw cycles.

Background: Nurr1/NGFI-B beta/NR4A2

This gene encodes a member of the steroid-thyroid hormone-retinoid receptor superfamily. The encoded protein may act as a transcription factor. Mutations in this gene have been associated with disorders related to dopaminergic dysfunction, including Parkinson disease, schizophernia, and manic depression. Misregulation of this gene may be associated with rheumatoid arthritis. Four transcript variants encoding four distinct isoforms have been identified for this gene. Additional alternate splice variants may exist, but their full length nature has not been determined. NR4A2( AAH66890, 71 a.a. - 170 a.a.) partial recombinant protein with GST.

Long Name

Nur-related Factor 1/Nerve Growth Factor Induced B beta/Nuclear Receptor Subfamily 4, Group A, 2

Alternate Names

NGFI-B beta, NOT, NR4A2, TINUR

Gene Symbol

NR4A2

Additional Nurr1/NGFI-B beta/NR4A2 Products

Product Documents for Recombinant Human Nurr1/NGFI-B beta/NR4A2 GST (N-Term) Protein

Product Datasheets

Download Product Datasheets

COA

SDS

Download SDS

Product Specific Notices for Recombinant Human Nurr1/NGFI-B beta/NR4A2 GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Citations
Reviews