Oncomodulin Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-14568PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-14568PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

View all Oncomodulin Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human OCM.

Source: E. coli

Amino Acid Sequence: MSITDVLSADDIAAALQECRDPDTFEPQKFFQTSGLSKMSA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-14568.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-14568PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: Oncomodulin

Oncomodulin (OM; also parvalbumin beta) is a 12-14 kDa member of the parvalbumin family of Ca++ binding proteins. It is expressed in early embryonic cells, placenta, and in tumors. OM was originally thought to have expression restricted to neoplastic tissues, early embryonic cells and certain tumor cell lines. Recent research shows that oncomodulin is also expressed and secreted by macrophages where, in the retina, it binds to retinal ganglion cells (RGCs) and functions to promote axon regenerationin early embryonic cells, placenta, and in tumors. OM is both cytoplasmic, and secreted. Rat OM is 109 amino acids (aa) in length. It contains a vestigial Ca++ binding site (aa 7-33) and two EF hand domains, the latter of which contains one high affinity Ca++ binding site (aa 81-108). Relative to parvalbumin alpha, OM has a lower pI (<4.8), a higher affinity for Ca++, and they share only 50% aa identity. Full length rat OM shares 95% and 89% aa identity with mouse and human OM, respectively.

Alternate Names

OCM, OCM1, OCMN, OM, ONCM, Parvalbumin beta

Gene Symbol

OCM

Additional Oncomodulin Products

Product Documents for Oncomodulin Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Oncomodulin Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.