Recombinant Human OR2A2 GST (N-Term) Protein

Name: Recombinant Human OR2A2 GST (N-Term) Protein
Brand: Novus Biologicals
SKU: H00442361-Q01

Novus Biologicals, part of Bio-Techne | Catalog # H00442361-Q01

Submit a review

Product Datasheet / COA

100% Guarantee

Product Specifications
Scientific Data
Preparation & Storage
Background
Product Documents
Specific Notices

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

ELISA, Affinity Purification, Microarray, Western Blot

View all OR2A2 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 261-318 of Human OR2A2

Source: Wheat Germ (in vitro)

Amino Acid Sequence: PDSNQREEQEKMLSLFHSVLNPMLNPLIYSLRNAQLKGALHRALQRKRSMRTVYGLCL

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

32.12 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human OR2A2 GST (N-Term) Protein

12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation and Storage

H00442361-Q01

Preparation Method	in vitro wheat germ expression system
Formulation	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative	No Preservative
Concentration	Please see the vial label for concentration. If unlisted please contact technical services.
Shipping	The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage	Store at -80C. Avoid freeze-thaw cycles.

Background: OR2A2

Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. [provided by RefSeq]

Alternate Names

Olfactory receptor 2A17, olfactory receptor 2A2, Olfactory receptor OR7-11, olfactory receptor, family 2, subfamily A, member 17 pseudogene, olfactory receptor, family 2, subfamily A, member 2, olfactory receptor, family 2, subfamily A, member 2 pseudogene, OR2A17P, OR2A2P, OR7-11, OST008

Gene Symbol

OR2A2

Additional OR2A2 Products

Product Documents for Recombinant Human OR2A2 GST (N-Term) Protein

Product Datasheets

Download Product Datasheets

COA

Product Specific Notices for Recombinant Human OR2A2 GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Citations
Reviews