Skip to main content

OR2T1 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-32375PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-32375PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human OR2T1.

Source: E. coli

Amino Acid Sequence: PWECYHLIWKILPYIGTTVGSMEEYNTSSTDFTFMGLFNRKETS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-32375.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-32375PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: OR2T1

OR2T1, also known as Olfactory receptor 2T1, is a 41.2 kDa, 369 amino acid protein that is involved in olfactory signal transduction as a member of the olfactory receptor gene family. Neuronitis is currently being studied for its potential link to the protein. The protein interacts in GPCR downstream signaling and olfactory signaling pathways with OR2T6, OR1J2, OR52E6, GNAL, and OR2M4 proteins.

Alternate Names

olfactory receptor 2T1, Olfactory receptor OR1-61, olfactory receptor, family 2, subfamily T, member 1, OR1-25Olfactory receptor 1-25

Gene Symbol

OR2T1

Additional OR2T1 Products

Product Documents for OR2T1 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for OR2T1 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...